SCOP 1.75: Domain d1gpzb3: 1gpz B:358-433

Lineage for d1gpzb3 (1gpz B:358-433)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (14 proteins)
   Pfam PF00084

6. Protein Complement C1R protease domains [75682] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75683] (4 PDB entries)

8. Domain d1gpzb3: 1gpz B:358-433 [70307]
   Other proteins in same PDB: d1gpza1, d1gpzb1
   complexed with fuc, man, nag; mutant

Details for d1gpzb3

PDB Entry: 1gpz, 2.9 Å

PDB Description: the crystal structure of the zymogen catalytic domain of complement protease c1r

PDB Compounds: (B:) complement c1r component

SCOP Domain Sequences for d1gpzb3:

Sequence, based on SEQRES records:

>d1gpzb3 g.18.1.1 (B:358-433) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]}
dcgqprnlpngdfrytttmgvntykariqyychepyykmqtragsreseqgvytctaqgi
wkneqkgekiprclpv

Sequence, based on observed residues (ATOM records):

>d1gpzb3 g.18.1.1 (B:358-433) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]}
dcgqprnlpngdfrytttmgvntykariqyychepyykmqtgvytctaqgiwkneqkgek
iprclpv

Timeline for d1gpzb3:

• d1gpzb3 first appeared in SCOP 1.61
  
• d1gpzb3 appears in SCOP 1.73
  
• d1gpzb3 appears in SCOPe 2.01
  
• d1gpzb3 appears in the current release, SCOPe 2.08