Lineage for d1gpzb3 (1gpz B:358-433)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 204192Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
  4. 204193Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) (S)
  5. 204194Family g.18.1.1: Complement control module/SCR domain [57536] (8 proteins)
  6. 204223Protein Complement C1R protease domains [75682] (1 species)
  7. 204224Species Human (Homo sapiens) [TaxId:9606] [75683] (1 PDB entry)
  8. 204228Domain d1gpzb3: 1gpz B:358-433 [70307]
    Other proteins in same PDB: d1gpza1, d1gpzb1

Details for d1gpzb3

PDB Entry: 1gpz (more details), 2.9 Å

PDB Description: the crystal structure of the zymogen catalytic domain of complement protease c1r

SCOP Domain Sequences for d1gpzb3:

Sequence, based on SEQRES records: (download)

>d1gpzb3 g.18.1.1 (B:358-433) Complement C1R protease domains {Human (Homo sapiens)}
dcgqprnlpngdfrytttmgvntykariqyychepyykmqtragsreseqgvytctaqgi
wkneqkgekiprclpv

Sequence, based on observed residues (ATOM records): (download)

>d1gpzb3 g.18.1.1 (B:358-433) Complement C1R protease domains {Human (Homo sapiens)}
dcgqprnlpngdfrytttmgvntykariqyychepyykmqtgvytctaqgiwkneqkgek
iprclpv

SCOP Domain Coordinates for d1gpzb3:

Click to download the PDB-style file with coordinates for d1gpzb3.
(The format of our PDB-style files is described here.)

Timeline for d1gpzb3: