Lineage for d1gpzb2 (1gpz B:290-357)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1462047Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 1462048Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) (S)
  5. 1462049Family g.18.1.1: Complement control module/SCR domain [57536] (14 proteins)
    Pfam PF00084
  6. 1462084Protein Complement C1R protease domains [75682] (1 species)
  7. 1462085Species Human (Homo sapiens) [TaxId:9606] [75683] (3 PDB entries)
  8. 1462089Domain d1gpzb2: 1gpz B:290-357 [70306]
    Other proteins in same PDB: d1gpza1, d1gpzb1
    complexed with nag

Details for d1gpzb2

PDB Entry: 1gpz (more details), 2.9 Å

PDB Description: the crystal structure of the zymogen catalytic domain of complement protease c1r
PDB Compounds: (B:) complement c1r component

SCOPe Domain Sequences for d1gpzb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpzb2 g.18.1.1 (B:290-357) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]}
ikcpqpktldeftiiqnlqpqyqfrdyfiatckqgyqliegnqvlhsftavcqddgtwhr
amprckik

SCOPe Domain Coordinates for d1gpzb2:

Click to download the PDB-style file with coordinates for d1gpzb2.
(The format of our PDB-style files is described here.)

Timeline for d1gpzb2: