SCOP 1.63: Domain d1gpzb2: 1gpz B:290-357

Lineage for d1gpzb2 (1gpz B:290-357)

1. Root: SCOP 1.63

2. Class g: Small proteins [56992] (61 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulphide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (8 proteins)

6. Protein Complement C1R protease domains [75682] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75683] (1 PDB entry)

8. Domain d1gpzb2: 1gpz B:290-357 [70306]
   Other proteins in same PDB: d1gpza1, d1gpzb1

Details for d1gpzb2

PDB Entry: 1gpz, 2.9 Å

PDB Description: the crystal structure of the zymogen catalytic domain of complement protease c1r

SCOP Domain Sequences for d1gpzb2:

Sequence; same for both SEQRES and ATOM records:

>d1gpzb2 g.18.1.1 (B:290-357) Complement C1R protease domains {Human (Homo sapiens)}
ikcpqpktldeftiiqnlqpqyqfrdyfiatckqgyqliegnqvlhsftavcqddgtwhr
amprckik

Timeline for d1gpzb2:

• d1gpzb2 first appeared in SCOP 1.61
  
• d1gpzb2 appears in SCOP 1.65
  
• d1gpzb2 appears in the current release, SCOPe 2.08