SCOPe 2.08: Domain d1gpzb2: 1gpz B:290-357

Lineage for d1gpzb2 (1gpz B:290-357)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
   Pfam PF00084

6. Protein Complement C1R protease domains [75682] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75683] (3 PDB entries)

8. Domain d1gpzb2: 1gpz B:290-357 [70306]
   Other proteins in same PDB: d1gpza1, d1gpzb1
   complexed with nag

Details for d1gpzb2

PDB Entry: 1gpz, 2.9 Å

PDB Description: the crystal structure of the zymogen catalytic domain of complement protease c1r

PDB Compounds: (B:) complement c1r component

SCOPe Domain Sequences for d1gpzb2:

Sequence; same for both SEQRES and ATOM records:

>d1gpzb2 g.18.1.1 (B:290-357) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]}
ikcpqpktldeftiiqnlqpqyqfrdyfiatckqgyqliegnqvlhsftavcqddgtwhr
amprckik

Timeline for d1gpzb2:

• d1gpzb2 first appeared in SCOP 1.61
  
• d1gpzb2 appears in SCOPe 2.07