SCOPe 2.03: Domain d1gpzb1: 1gpz B:434-685

Lineage for d1gpzb1 (1gpz B:434-685)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Complement C1R protease, catalytic domain [74976] (1 species)
7. Species Human (Homo sapiens) [TaxId:9606] [74977] (3 PDB entries)

8. Domain d1gpzb1: 1gpz B:434-685 [70305]
   Other proteins in same PDB: d1gpza2, d1gpza3, d1gpzb2, d1gpzb3
   complexed with nag

Details for d1gpzb1

PDB Entry: 1gpz, 2.9 Å

PDB Description: the crystal structure of the zymogen catalytic domain of complement protease c1r

PDB Compounds: (B:) complement c1r component

SCOPe Domain Sequences for d1gpzb1:

Sequence, based on SEQRES records:

>d1gpzb1 b.47.1.2 (B:434-685) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
cgkpvnpveqrqqiiggqkakmgnfpwqvftnihgrgggallgdrwiltaahtlypkehe
aqsnasldvflghtnveelmklgnhpirrvsvhpdyrqdesynfegdiallelensvtlg
pnllpiclpdndtfydlglmgyvsgfgvmeekiahdlrfvrlpvanpqacenwlrgknrm
dvfsqnmfcaghpslkqdacqgdsggvfavrdpntdrwvatgivswgigcsrgygfytkv
lnyvdwikkeme

Sequence, based on observed residues (ATOM records):

>d1gpzb1 b.47.1.2 (B:434-685) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
cgkpvnpveqrqqiiggqkakmgnfpwqvftnihgrgggallgdrwiltaahtlypkehq
snasldvflghtnveelmklgnhpirrvsvhpdyrqdesynfegdiallelensvtlgpn
llpiclpdndtfydlglmgyvsgfgiahdlrfvrlpvanpqaceqnmfcaghpslkqdac
qgdsggvfavrdpntdrwvatgivswgigcsrgygfytkvlnyvdwikkeme

Timeline for d1gpzb1:

• d1gpzb1 first appeared in SCOP 1.61
  
• d1gpzb1 appears in SCOPe 2.02
  
• d1gpzb1 appears in SCOPe 2.04
  
• d1gpzb1 appears in the current release, SCOPe 2.08