![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
![]() | Protein Complement C1R protease, catalytic domain [74976] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [74977] (4 PDB entries) |
![]() | Domain d1gpzb1: 1gpz B:434-685 [70305] Other proteins in same PDB: d1gpza2, d1gpza3, d1gpzb2, d1gpzb3 complexed with nag |
PDB Entry: 1gpz (more details), 2.9 Å
SCOPe Domain Sequences for d1gpzb1:
Sequence, based on SEQRES records: (download)
>d1gpzb1 b.47.1.2 (B:434-685) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} cgkpvnpveqrqqiiggqkakmgnfpwqvftnihgrgggallgdrwiltaahtlypkehe aqsnasldvflghtnveelmklgnhpirrvsvhpdyrqdesynfegdiallelensvtlg pnllpiclpdndtfydlglmgyvsgfgvmeekiahdlrfvrlpvanpqacenwlrgknrm dvfsqnmfcaghpslkqdacqgdsggvfavrdpntdrwvatgivswgigcsrgygfytkv lnyvdwikkeme
>d1gpzb1 b.47.1.2 (B:434-685) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} cgkpvnpveqrqqiiggqkakmgnfpwqvftnihgrgggallgdrwiltaahtlypkehq snasldvflghtnveelmklgnhpirrvsvhpdyrqdesynfegdiallelensvtlgpn llpiclpdndtfydlglmgyvsgfgiahdlrfvrlpvanpqaceqnmfcaghpslkqdac qgdsggvfavrdpntdrwvatgivswgigcsrgygfytkvlnyvdwikkeme
Timeline for d1gpzb1: