SCOP 1.67: Domain d1gn1d_: 1gn1 D:

Lineage for d1gn1d_ (1gn1 D:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (8 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.5: GroEL apical domain-like [52029] (2 families)

5. Family c.8.5.2: Group II chaperonin (CCT, TRIC), apical domain [52034] (1 protein)

6. Protein Thermosome, A-domain [52035] (4 species)

7. Species Mouse (Mus musculus), gamma chain [TaxId:10090] [75137] (2 PDB entries)

8. Domain d1gn1d_: 1gn1 D: [70280]

Details for d1gn1d_

PDB Entry: 1gn1, 2.8 Å

PDB Description: crystal structure of the mouse cct gamma apical domain (monoclinic)

SCOP Domain Sequences for d1gn1d_:

Sequence, based on SEQRES records:

>d1gn1d_ c.8.5.2 (D:) Thermosome, A-domain {Mouse (Mus musculus), gamma chain}
vlrgvminkdvthprmrryiknprivlldssleykkgesqtdieitreedftrilqmeee
yihqlcediiqlkpdvvitekgisdlaqhylmranvtairrvrktdnnriaracgarivs
rpeelreddvgtgaglleikkigdeyftfitdckdpkactillrg

Sequence, based on observed residues (ATOM records):

>d1gn1d_ c.8.5.2 (D:) Thermosome, A-domain {Mouse (Mus musculus), gamma chain}
vlrgvminkdvthprmrryiknprivlldssleyilqmeeeyihqlcediiqlkpdvvit
ekgisdlaqhylmranvtairrvrktdnnriaracgarivsrpeelreddvgtgagllei
kkigdeyftfitdckdpkactillrg

Timeline for d1gn1d_:

• d1gn1d_ first appeared in SCOP 1.61
  
• d1gn1d_ appears in SCOP 1.65
  
• d1gn1d_ appears in SCOP 1.69
  
• d1gn1d_ appears in the current release, SCOPe 2.08