Lineage for d1gl7d_ (1gl7 D:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 179955Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (7 proteins)
  6. 179970Protein Bacterial conjugative coupling protein TrwB [69492] (1 species)
  7. 179971Species Escherichia coli [TaxId:562] [69493] (5 PDB entries)
  8. 180004Domain d1gl7d_: 1gl7 D: [70267]

Details for d1gl7d_

PDB Entry: 1gl7 (more details), 3 Å

PDB Description: plasmid coupling protein trwb in complex with the non-hydrolisable atp-analogue adpnp.

SCOP Domain Sequences for d1gl7d_:

Sequence, based on SEQRES records: (download)

>d1gl7d_ c.37.1.11 (D:) Bacterial conjugative coupling protein TrwB {Escherichia coli}
gqgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgt
gksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirnd
ydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddl
rgflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlf
itwredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkg
rkaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgehe
verdryskntgkhhstgralervrervvmpaeianlpdltayvgfagnrpiakvpleikq
fanrqpafveg

Sequence, based on observed residues (ATOM records): (download)

>d1gl7d_ c.37.1.11 (D:) Bacterial conjugative coupling protein TrwB {Escherichia coli}
gqgefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgt
gksvllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirnd
ydwqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddl
rgflegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlf
itwredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkg
rkaglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgehe
verdrlervrervvmpaeianlpdltayvgfagnrpiakvpleikqfanrqpafveg

SCOP Domain Coordinates for d1gl7d_:

Click to download the PDB-style file with coordinates for d1gl7d_.
(The format of our PDB-style files is described here.)

Timeline for d1gl7d_: