Lineage for d1gl6g_ (1gl6 G:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 179955Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (7 proteins)
  6. 179970Protein Bacterial conjugative coupling protein TrwB [69492] (1 species)
  7. 179971Species Escherichia coli [TaxId:562] [69493] (5 PDB entries)
  8. 179995Domain d1gl6g_: 1gl6 G: [70264]

Details for d1gl6g_

PDB Entry: 1gl6 (more details), 2.8 Å

PDB Description: plasmid coupling protein trwb in complex with the non-hydrolysable gtp analogue gdpnp

SCOP Domain Sequences for d1gl6g_:

Sequence, based on SEQRES records: (download)

>d1gl6g_ c.37.1.11 (G:) Bacterial conjugative coupling protein TrwB {Escherichia coli}
gefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgtgk
svllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirndyd
wqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlrg
flegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlfit
wredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkgrk
aglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgeheve
rdryskntgkhhstgralervrervvmpaeianlpdltayvgfagnrpiakvpleikqfa
nrqpafveg

Sequence, based on observed residues (ATOM records): (download)

>d1gl6g_ c.37.1.11 (G:) Bacterial conjugative coupling protein TrwB {Escherichia coli}
gefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgtgk
svllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirndyd
wqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlrg
flegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlfit
wredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkgrk
aglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgeheve
rdlervrervvmpaeianlpdltayvgfagnrpiakvpleikqfanrqpafveg

SCOP Domain Coordinates for d1gl6g_:

Click to download the PDB-style file with coordinates for d1gl6g_.
(The format of our PDB-style files is described here.)

Timeline for d1gl6g_: