Lineage for d1gkif_ (1gki F:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242911Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 242912Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families) (S)
    division into families based on beta-sheet topologies
  5. 243788Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (9 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 243803Protein Bacterial conjugative coupling protein TrwB [69492] (1 species)
  7. 243804Species Escherichia coli [TaxId:562] [69493] (5 PDB entries)
  8. 243833Domain d1gkif_: 1gki F: [70225]

Details for d1gkif_

PDB Entry: 1gki (more details), 3 Å

PDB Description: plasmid coupling protein trwb in complex with adp and mg2+.
PDB Compounds: (F:)

SCOP Domain Sequences for d1gkif_:

Sequence, based on SEQRES records: (download)

>d1gkif_ c.37.1.11 (F:) Bacterial conjugative coupling protein TrwB {Escherichia coli}
gefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgtgk
svllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirndyd
wqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlrg
flegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlfit
wredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkgrk
aglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgeheve
rdryskntgkhhstgralervrervvmpaeianlpdltayvgfagnrpiakvpleikqfa
nrqpafve

Sequence, based on observed residues (ATOM records): (download)

>d1gkif_ c.37.1.11 (F:) Bacterial conjugative coupling protein TrwB {Escherichia coli}
gefggapfkrflrgtrivsggklkrmtrekakqvtvagvpmprdaeprhllvngatgtgk
svllrelaytgllrgdrmvivdpngdmlskfgrdkdiilnpydqrtkgwsffneirndyd
wqryalsvvprgktdeaeewasygrlllretakklaligtpsmrelfhwttiatfddlrg
flegtlaeslfagsneaskaltsarfvlsdklpehvtmpdgdfsirswledpnggnlfit
wredmgpalrplisawvdvvctsilslpeepkrrlwlfidelasleklasladaltkgrk
aglrvvaglqstsqlddvygvkeaqtlrasfrslvvlggsrtdpktnedmslslgeheve
rdervrervvmpaeianlpdltayvgfagnrpiakvpleikqfanrqpafve

SCOP Domain Coordinates for d1gkif_:

Click to download the PDB-style file with coordinates for d1gkif_.
(The format of our PDB-style files is described here.)

Timeline for d1gkif_: