Lineage for d1gk4e_ (1gk4 E:)

  1. Root: SCOP 1.63
  2. 271841Class h: Coiled coil proteins [57942] (6 folds)
  3. 271842Fold h.1: Parallel coiled-coil [57943] (22 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 272435Superfamily h.1.20: Vimentin coil [64593] (1 family) (S)
  5. 272436Family h.1.20.1: Vimentin coil [64594] (1 protein)
  6. 272437Protein Vimentin coil [64595] (1 species)
  7. 272438Species Human (Homo sapiens) [TaxId:9606] [64596] (4 PDB entries)
  8. 272448Domain d1gk4e_: 1gk4 E: [70207]

Details for d1gk4e_

PDB Entry: 1gk4 (more details), 2.3 Å

PDB Description: human vimentin coil 2b fragment (cys2)

SCOP Domain Sequences for d1gk4e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gk4e_ h.1.20.1 (E:) Vimentin coil {Human (Homo sapiens)}
neslerqmremeenfaveaanyqdtigrlqdeiqnmkeemarhlreyqdllnvkmaldie
iatyrklleg

SCOP Domain Coordinates for d1gk4e_:

Click to download the PDB-style file with coordinates for d1gk4e_.
(The format of our PDB-style files is described here.)

Timeline for d1gk4e_: