Class h: Coiled coil proteins [57942] (6 folds) |
Fold h.1: Parallel coiled-coil [57943] (22 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.20: Vimentin coil [64593] (1 family) |
Family h.1.20.1: Vimentin coil [64594] (1 protein) |
Protein Vimentin coil [64595] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [64596] (4 PDB entries) |
Domain d1gk4e_: 1gk4 E: [70207] |
PDB Entry: 1gk4 (more details), 2.3 Å
SCOP Domain Sequences for d1gk4e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gk4e_ h.1.20.1 (E:) Vimentin coil {Human (Homo sapiens)} neslerqmremeenfaveaanyqdtigrlqdeiqnmkeemarhlreyqdllnvkmaldie iatyrklleg
Timeline for d1gk4e_: