Lineage for d1gjyd_ (1gjy D:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768455Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 768456Superfamily a.39.1: EF-hand [47473] (11 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 769216Family a.39.1.8: Penta-EF-hand proteins [63550] (6 proteins)
  6. 769269Protein Sorcin [69023] (2 species)
  7. 769270Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [74723] (1 PDB entry)
  8. 769274Domain d1gjyd_: 1gjy D: [70202]
    complexed with so4

Details for d1gjyd_

PDB Entry: 1gjy (more details), 2.2 Å

PDB Description: the x-ray structure of the sorcin calcium binding domain (scbd) provides insight into the phosphorylation and calcium dependent processess
PDB Compounds: (D:) sorcin

SCOP Domain Sequences for d1gjyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gjyd_ a.39.1.8 (D:) Sorcin {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
mdplygyfasvagqdgqidadelqrcltqsgiaggykpfnletcrlmvsmldrdmsgtmg
fnefkelwavlngwrqhfisfdsdrsgtvdpqelqkalttmgfrlnpqtvnsiakrysts
gkitfddyiaccvklraltdsfrrrdsaqqgmvnfsyddfiqcvmtv

SCOP Domain Coordinates for d1gjyd_:

Click to download the PDB-style file with coordinates for d1gjyd_.
(The format of our PDB-style files is described here.)

Timeline for d1gjyd_: