SCOP 1.75: Domain d1gjyc_: 1gjy C:

Lineage for d1gjyc_ (1gjy C:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (11 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.8: Penta-EF-hand proteins [63550] (6 proteins)

6. Protein Sorcin [69023] (2 species)

7. Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [74723] (1 PDB entry)

8. Domain d1gjyc_: 1gjy C: [70201]

Details for d1gjyc_

PDB Entry: 1gjy, 2.2 Å

PDB Description: the x-ray structure of the sorcin calcium binding domain (scbd) provides insight into the phosphorylation and calcium dependent processess

PDB Compounds: (C:) sorcin

SCOP Domain Sequences for d1gjyc_:

Sequence; same for both SEQRES and ATOM records:

>d1gjyc_ a.39.1.8 (C:) Sorcin {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
mdplygyfasvagqdgqidadelqrcltqsgiaggykpfnletcrlmvsmldrdmsgtmg
fnefkelwavlngwrqhfisfdsdrsgtvdpqelqkalttmgfrlnpqtvnsiakrysts
gkitfddyiaccvklraltdsfrrrdsaqqgmvnfsyddfiqcvmtv

Timeline for d1gjyc_:

• d1gjyc_ first appeared in SCOP 1.61
  
• d1gjyc_ appears in SCOP 1.73
  
• d1gjyc_ appears in SCOPe 2.01
  
• d1gjyc_ appears in the current release, SCOPe 2.08