Lineage for d1gjyc_ (1gjy C:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 640657Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 640658Superfamily a.39.1: EF-hand [47473] (11 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 641308Family a.39.1.8: Penta-EF-hand proteins [63550] (6 proteins)
  6. 641361Protein Sorcin [69023] (2 species)
  7. 641362Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [74723] (1 PDB entry)
  8. 641365Domain d1gjyc_: 1gjy C: [70201]

Details for d1gjyc_

PDB Entry: 1gjy (more details), 2.2 Å

PDB Description: the x-ray structure of the sorcin calcium binding domain (scbd) provides insight into the phosphorylation and calcium dependent processess
PDB Compounds: (C:) sorcin

SCOP Domain Sequences for d1gjyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gjyc_ a.39.1.8 (C:) Sorcin {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
mdplygyfasvagqdgqidadelqrcltqsgiaggykpfnletcrlmvsmldrdmsgtmg
fnefkelwavlngwrqhfisfdsdrsgtvdpqelqkalttmgfrlnpqtvnsiakrysts
gkitfddyiaccvklraltdsfrrrdsaqqgmvnfsyddfiqcvmtv

SCOP Domain Coordinates for d1gjyc_:

Click to download the PDB-style file with coordinates for d1gjyc_.
(The format of our PDB-style files is described here.)

Timeline for d1gjyc_: