![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (10 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.8: Penta-EF-hand proteins [63550] (6 proteins) |
![]() | Protein Sorcin [69023] (2 species) |
![]() | Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [74723] (1 PDB entry) |
![]() | Domain d1gjyb_: 1gjy B: [70200] |
PDB Entry: 1gjy (more details), 2.2 Å
SCOP Domain Sequences for d1gjyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gjyb_ a.39.1.8 (B:) Sorcin {Chinese hamster (Cricetulus griseus)} mdplygyfasvagqdgqidadelqrcltqsgiaggykpfnletcrlmvsmldrdmsgtmg fnefkelwavlngwrqhfisfdsdrsgtvdpqelqkalttmgfrlnpqtvnsiakrysts gkitfddyiaccvklraltdsfrrrdsaqqgmvnfsyddfiqcvmtv
Timeline for d1gjyb_: