Lineage for d1gjyb_ (1gjy B:)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.39: EF Hand-like [47472] (4 superfamilies) Superfamily a.39.1: EF-hand [47473] (8 families) 
Family a.39.1.8: Penta-EF-hand proteins [63550] (2 proteins) Protein Sorcin [69023] (2 species) 
Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [74723] (1 PDB entry) 
Domain d1gjyb_: 1gjy B: [70200]
Details for d1gjyb_
PDB Entry: 1gjy (more details), 2.2 Å
PDB Description: the x-ray structure of the sorcin calcium binding domain (scbd) provides insight into the phosphorylation and calcium dependent processess
SCOP Domain Sequences for d1gjyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gjyb_ a.39.1.8 (B:) Sorcin {Chinese hamster (Cricetulus griseus)}
mdplygyfasvagqdgqidadelqrcltqsgiaggykpfnletcrlmvsmldrdmsgtmg
fnefkelwavlngwrqhfisfdsdrsgtvdpqelqkalttmgfrlnpqtvnsiakrysts
gkitfddyiaccvklraltdsfrrrdsaqqgmvnfsyddfiqcvmtv
SCOP Domain Coordinates for d1gjyb_:
Click to download the PDB-style file with coordinates for d1gjyb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gjyb_:
- d1gjyb_ is new in SCOP 1.61
- d1gjyb_ appears in SCOP 1.63
- d1gjyb_ appears in the current release, SCOPe 2.08
View in 3D
