Lineage for d1gjoa_ (1gjo A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 197199Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 197200Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
  5. 197388Family d.144.1.2: Tyrosine kinase [56150] (13 proteins)
  6. 197429Protein Fibroblast growth factor receptor 2 [75562] (1 species)
  7. 197430Species Human (Homo sapiens) [TaxId:9606] [75563] (1 PDB entry)
  8. 197431Domain d1gjoa_: 1gjo A: [70192]

Details for d1gjoa_

PDB Entry: 1gjo (more details), 2.4 Å

PDB Description: the fgfr2 tyrosine kinase domain
PDB Compounds: (A:)

SCOP Domain Sequences for d1gjoa_:

Sequence, based on SEQRES records: (download)

>d1gjoa_ d.144.1.2 (A:) Fibroblast growth factor receptor 2 {Human (Homo sapiens)}
elpedpkwefprdkltlgkplgegcfgqvvmaeavgidkdkpkeavtvavkmlkddatek
dlsdlvsememmkmigkhkniinllgactqdgplyviveyaskgnlreylrarrppgmey
sydinrvpeeqmtfkdlvsctyqlargmeylasqkcihrdlaarnvlvtennvmkiadfg
lardinnidyykkttngrlpvkwmapealfdrvythqsdvwsfgvlmweiftlggspypg
ipveelfkllkeghrmdkpanctnelymmmrdcwhavpsqrptfkqlvedldriltlt

Sequence, based on observed residues (ATOM records): (download)

>d1gjoa_ d.144.1.2 (A:) Fibroblast growth factor receptor 2 {Human (Homo sapiens)}
elpedpkwefprdkltlgkplgegcfgqvvmaeavgikpkeavtvavkmlkddatekdls
dlvsememmkmigkhkniinllgactqdgplyviveyaskgnlreylrarreqmtfkdlv
sctyqlargmeylasqkcihrdlaarnvlvtennvmkiadfglardinnidyykkttngr
lpvkwmapealfdrvythqsdvwsfgvlmweiftlggspypgipveelfkllkeghrmdk
panctnelymmmrdcwhavpsqrptfkqlvedldriltlt

SCOP Domain Coordinates for d1gjoa_:

Click to download the PDB-style file with coordinates for d1gjoa_.
(The format of our PDB-style files is described here.)

Timeline for d1gjoa_: