![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (18 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (6 proteins) subgroup of the larger IPT/TIG domain family |
![]() | Protein p65 subunit of NF-kappa B (NFKB), dimerization domain [49253] (3 species) |
![]() | Species Chicken (Gallus gallus), C-rel [TaxId:9031] [74848] (1 PDB entry) |
![]() | Domain d1gjia1: 1gji A:182-281 [70187] Other proteins in same PDB: d1gjia2, d1gjib2 |
PDB Entry: 1gji (more details), 2.85 Å
SCOP Domain Sequences for d1gjia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gjia1 b.1.18.1 (A:182-281) p65 subunit of NF-kappa B (NFKB), dimerization domain {Chicken (Gallus gallus), C-rel} taelricrvnkncgsvkggdeifilcdkvqkddievrfvldnweakgsfsqadvhrqvai vfrtppflrditepitvkmqlrrpsdqevsepmdfrylpd
Timeline for d1gjia1: