Lineage for d1gj9.1 (1gj9 A:,B:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 802045Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 802046Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 802237Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 803442Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species)
  7. 803443Species Human (Homo sapiens) [TaxId:9606] [50587] (49 PDB entries)
    Uniprot P00749 156-178,179-424
  8. 803461Domain d1gj9.1: 1gj9 A:,B: [70182]
    complexed with 134, cit; mutant

Details for d1gj9.1

PDB Entry: 1gj9 (more details), 1.8 Å

PDB Description: engineering inhibitors highly selective for the s1 sites of ser190 trypsin-like serine protease drug targets
PDB Compounds: (A:) urokinase-type plasminogen activator, (B:) urokinase-type plasminogen activator

SCOP Domain Sequences for d1gj9.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1gj9.1 b.47.1.2 (A:,B:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
lkfqcgqktlXiiggefttienqpwfaaiyrrhrggsvtyvcggslmspcwvisathcfi
dypkkedyivylgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegr
caqpsrtiqticlpsmyndpqfgtsceitgfgkeastdylypeqlkmtvvklishrecqq
phyygsevttkmlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpg
vytrvshflpwirshtk

SCOP Domain Coordinates for d1gj9.1:

Click to download the PDB-style file with coordinates for d1gj9.1.
(The format of our PDB-style files is described here.)

Timeline for d1gj9.1: