Lineage for d1g9ha2 (1g9h A:1-354)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
members of the family may contain various insert subdomains
in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
Protein Bacterial alpha-amylase [51447] (10 species) 
Species Pseudoalteromonas haloplanktis [TaxId:228] [51449] (9 PDB entries) 
Domain d1g9ha2: 1g9h A:1-354 [70163]
Other proteins in same PDB: d1g9ha1
complexed with ca, cl, trs
Details for d1g9ha2
PDB Entry: 1g9h (more details), 1.8 Å
PDB Description: ternary complex between psychrophilic alpha-amylase, comii (pseudo tri-saccharide from bayer) and tris (2-amino-2-hydroxymethyl-propane- 1,3-diol)
PDB Compounds: (A:) alpha-amylaseSCOPe Domain Sequences for d1g9ha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g9ha2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis [TaxId: 228]}
tpttfvhlfewnwqdvaqeceqylgpkgyaavqvsppnehitgsqwwtryqpvsyelqsr
ggnraqfidmvnrcsaagvdiyvdtlinhmaagsgtgtagnsfgnksfpiyspqdfhesc
tinnsdygndryrvqncelvgladldtasnyvqntiaayindlqaigvkgfrfdaskhva
asdiqslmakvngspvvfqevidqggeavgaseylstglvtefkystelgntfrngslaw
lsnfgegwgfmpsssavvfvdnhdnqrghggagnvitfedgrlydlanvfmlaypygypk
vmssydfhgdtdaggpnvpvhnngnlecfasnwkcehrwsyiaggvdfrnntad
SCOPe Domain Coordinates for d1g9ha2:
Click to download the PDB-style file with coordinates for d1g9ha2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g9ha2:
- d1g9ha2 first appeared in SCOP 1.61
- d1g9ha2 appears in SCOPe 2.07
View in 3D
