| Class b: All beta proteins [48724] (180 folds) |
| Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
| Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
| Protein Bacterial alpha-Amylase [51013] (9 species) |
| Species Pseudoalteromonas haloplanktis [TaxId:228] [51015] (9 PDB entries) |
| Domain d1g9ha1: 1g9h A:355-448 [70162] Other proteins in same PDB: d1g9ha2 complexed with ca, cl, trs |
PDB Entry: 1g9h (more details), 1.8 Å
SCOPe Domain Sequences for d1g9ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g9ha1 b.71.1.1 (A:355-448) Bacterial alpha-Amylase {Pseudoalteromonas haloplanktis [TaxId: 228]}
nwavtnwwdntnnqisfgrgssghmainkedstltatvqtdmasgqycnvlkgelsadak
scsgevitvnsdgtinlnigawdamaihknakln
Timeline for d1g9ha1: