![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
![]() | Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (52 PDB entries) Uniprot P01901 22-299 |
![]() | Domain d1g7qa2: 1g7q A:1-181 [70157] Other proteins in same PDB: d1g7qa1, d1g7qb_ complexed with nag |
PDB Entry: 1g7q (more details), 1.6 Å
SCOPe Domain Sequences for d1g7qa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g7qa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]} gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll r
Timeline for d1g7qa2: