Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Class I MHC, alpha-3 domain [88604] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88606] (60 PDB entries) |
Domain d1g7qa1: 1g7q A:182-274 [70156] Other proteins in same PDB: d1g7qa2, d1g7qb_ complexed with fuc, nag |
PDB Entry: 1g7q (more details), 1.6 Å
SCOP Domain Sequences for d1g7qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g7qa1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus)} tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf qkwasvvvplgkeqyytchvyhqglpepltlrw
Timeline for d1g7qa1: