Lineage for d1fnoa3 (1fno A:208-320)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 328742Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 329588Superfamily d.58.19: Bacterial exopeptidase dimerisation domain [55031] (1 family) (S)
  5. 329589Family d.58.19.1: Bacterial exopeptidase dimerisation domain [55032] (3 proteins)
  6. 329599Protein Peptidase T (tripeptidase) [75443] (1 species)
  7. 329600Species Salmonella typhimurium [TaxId:90371] [75444] (1 PDB entry)
  8. 329601Domain d1fnoa3: 1fno A:208-320 [70145]
    Other proteins in same PDB: d1fnoa4
    complexed with mse, so4, zn2

Details for d1fnoa3

PDB Entry: 1fno (more details), 2.4 Å

PDB Description: peptidase t (tripeptidase)

SCOP Domain Sequences for d1fnoa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnoa3 d.58.19.1 (A:208-320) Peptidase T (tripeptidase) {Salmonella typhimurium}
fnaasvnikivgnnvhpgtakgvmvnalslaarihaevpadeapettegyegfyhlasmk
gtvdraemhyiirdfdrkqfearkrkmmeiakkvgkglhpdcyielviedsyy

SCOP Domain Coordinates for d1fnoa3:

Click to download the PDB-style file with coordinates for d1fnoa3.
(The format of our PDB-style files is described here.)

Timeline for d1fnoa3:

Domains from same chain:
(mouse over for more information)
d1fnoa4