Lineage for d1fl9b_ (1fl9 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2478761Family c.37.1.18: YjeE-like [75213] (1 protein)
    mixed beta-sheet; order 234156(0), strands 2 and 6 are antiparallel to the rest
    automatically mapped to Pfam PF02367
  6. 2478762Protein Hypothetical protein HI0065 [75214] (1 species)
  7. 2478763Species Haemophilus influenzae [TaxId:727] [75215] (2 PDB entries)
  8. 2478768Domain d1fl9b_: 1fl9 B: [70138]
    structural genomics
    CASP4
    complexed with hg

Details for d1fl9b_

PDB Entry: 1fl9 (more details), 2.5 Å

PDB Description: the yjee protein
PDB Compounds: (B:) hypothetical protein hi0065

SCOPe Domain Sequences for d1fl9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fl9b_ c.37.1.18 (B:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]}
mesltqyipdefsmlrfgkkfaeillklhtekaimvylngdlgagkttltrgmlqgighq
gnvksptytlveeyniagkmiyhfdlyrladpeelefmgirdyfntdsicliewsekgqg
ilpeadilvnidyyddarnieliaqtnlgkniisafs

SCOPe Domain Coordinates for d1fl9b_:

Click to download the PDB-style file with coordinates for d1fl9b_.
(The format of our PDB-style files is described here.)

Timeline for d1fl9b_: