Lineage for d1ea9d1 (1ea9 D:1-121)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765186Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 2765362Protein Maltogenic amylase, N-terminal domain N [49221] (4 species)
    precedes the catalytic (beta/alpha)8-barrel domain
  7. 2765363Species Bacillus sp., cyclomaltodextrinase [TaxId:1409] [74842] (1 PDB entry)
  8. 2765365Domain d1ea9d1: 1ea9 D:1-121 [70090]
    Other proteins in same PDB: d1ea9c2, d1ea9c3, d1ea9d2, d1ea9d3
    has additional insertions and/or extensions that are not grouped together

Details for d1ea9d1

PDB Entry: 1ea9 (more details), 3.2 Å

PDB Description: cyclomaltodextrinase
PDB Compounds: (D:) cyclomaltodextrinase

SCOPe Domain Sequences for d1ea9d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ea9d1 b.1.18.2 (D:1-121) Maltogenic amylase, N-terminal domain N {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]}
mfleavyhrprknfsyayngttvhlrirtkkddmtavyalagdkymwdhtmeyvpmtkla
tdelfdywecevtppyrrvkygfllqqghekrwmteydflteppanpdrlfeypfinpvd
v

SCOPe Domain Coordinates for d1ea9d1:

Click to download the PDB-style file with coordinates for d1ea9d1.
(The format of our PDB-style files is described here.)

Timeline for d1ea9d1: