Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
Fold d.100: L9 N-domain-like [55657] (1 superfamily) |
Superfamily d.100.1: L9 N-domain-like [55658] (2 families) |
Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein) |
Protein Ribosomal protein L9 N-domain [55660] (1 species) |
Species Bacillus stearothermophilus [TaxId:1422] [55661] (2 PDB entries) |
Domain d1cqua_: 1cqu A: [70073] |
PDB Entry: 1cqu (more details)
SCOP Domain Sequences for d1cqua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cqua_ d.100.1.1 (A:) Ribosomal protein L9 N-domain {Bacillus stearothermophilus} mkviflkdvkgkgkkgeiknvadgyannflfkqglaieatpanlkaleaqkqkeqr
Timeline for d1cqua_: