| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) ![]() |
| Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) |
| Protein Staphylococcal enterotoxin C3, SEC3 [54344] (1 species) |
| Species Staphylococcus aureus [TaxId:1280] [54345] (18 PDB entries) Uniprot P23313 |
| Domain d1ck1a2: 1ck1 A:122-239 [70068] Other proteins in same PDB: d1ck1a1 complexed with zn |
PDB Entry: 1ck1 (more details), 2.6 Å
SCOPe Domain Sequences for d1ck1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ck1a2 d.15.6.1 (A:122-239) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus [TaxId: 1280]}
hfdngnlqnvlirvyenkrntisfevqtdkksvtaqeldikarnflinkknlyefnsspy
etgyikfiesngntfwydmmpapgdkfdqskylmiykdnkmvdsksvkievhlttkng
Timeline for d1ck1a2: