Lineage for d1ck1a1 (1ck1 A:1-121)
- Root: SCOP 1.63
Class b: All beta proteins [48724] (119 folds) 
Fold b.40: OB-fold [50198] (9 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) 
Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins) 
Protein Staphylococcal enterotoxin C3, SEC3 [50228] (1 species) Species Staphylococcus aureus [TaxId:1280] [50229] (2 PDB entries) 
Domain d1ck1a1: 1ck1 A:1-121 [70067]
Other proteins in same PDB: d1ck1a2
complexed with zn
Details for d1ck1a1
PDB Entry: 1ck1 (more details), 2.6 Å
PDB Description: structure of staphylococcal enterotoxin c3
SCOP Domain Sequences for d1ck1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ck1a1 b.40.2.2 (A:1-121) Staphylococcal enterotoxin C3, SEC3 {Staphylococcus aureus}
esqpdpmpddlhksseftgtmgnmkylyddhyvsatkvksvdkflahdliynindkklnn
ydkvktellnedlankykdevvdvygsnyyvncyfsskdnvgkvtsgktcmyggitkheg
n
SCOP Domain Coordinates for d1ck1a1:
Click to download the PDB-style file with coordinates for d1ck1a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ck1a1:
- d1ck1a1 first appeared in SCOP 1.61
- d1ck1a1 appears in SCOP 1.65
- d1ck1a1 appears in the current release, SCOPe 2.08
View in 3D
