Lineage for d1qgza1 (1qgz A:9-141)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies) Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) 
Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (8 proteins) Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species) 
Species Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId:1167] [50420] (13 PDB entries) 
Domain d1qgza1: 1qgz A:9-141 [68889]
Other proteins in same PDB: d1qgza2
Details for d1qgza1
PDB Entry: 1qgz (more details), 2.3 Å
PDB Description: ferredoxin:nadp+ reductase mutant with leu 78 replaced by asp (l78d)
SCOP Domain Sequences for d1qgza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qgza1 b.43.4.2 (A:9-141) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Cyanobacterium (Anabaena sp.), pcc 7119}
dvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsigiippgvd
kngkpeklrdysiastrhgddvddktislcvrqleykhpesgetvygvcstylthiepgs
evkitgpvgkeml
SCOP Domain Coordinates for d1qgza1:
Click to download the PDB-style file with coordinates for d1qgza1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qgza1:
- d1qgza1 first appeared in SCOP 1.59
- d1qgza1 appears in SCOP 1.63
- d1qgza1 appears in the current release, SCOPe 2.08
View in 3D
