SCOP 1.63: Domain d1kx2a_: 1kx2 A:

Lineage for d1kx2a_ (1kx2 A:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (14 proteins)

6. Protein Mono-heme c-type cytochrome ScyA [68948] (1 species)

7. Species Shewanella putrefaciens [TaxId:24] [68949] (2 PDB entries)

8. Domain d1kx2a_: 1kx2 A: [68878]
   complexed with hec

Details for d1kx2a_

PDB Entry: 1kx2

PDB Description: minimized average structure of a mono-heme ferrocytochrome c from shewanella putrefaciens

SCOP Domain Sequences for d1kx2a_:

Sequence; same for both SEQRES and ATOM records:

>d1kx2a_ a.3.1.1 (A:) Mono-heme c-type cytochrome ScyA {Shewanella putrefaciens}
adlqdaeaiynkactvchsmgvagapkshntadweprlakgvdnlvksvktglnamppgg
mctdctdedykaaiefmskak

Timeline for d1kx2a_:

• d1kx2a_ first appeared in SCOP 1.59
  
• d1kx2a_ appears in SCOP 1.61
  
• d1kx2a_ appears in SCOP 1.65
  
• d1kx2a_ appears in the current release, SCOPe 2.08, called d1kx2a1