Lineage for d1kusa_ (1kus A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 125751Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
  4. 125752Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) (S)
  5. 125753Family c.67.1.1: AAT-like [53384] (6 proteins)
  6. 125928Protein L-threonine-O-3-phosphate decarboxylase CobD [69563] (1 species)
  7. 125929Species Salmonella enterica [TaxId:28901] [69564] (1 PDB entry)
  8. 125930Domain d1kusa_: 1kus A: [68872]

Details for d1kusa_

PDB Entry: 1kus (more details), 1.8 Å

PDB Description: The Three-Dimensional Structure of L-Threonine-O-3-phosphate Decarboxylase from Salmonella enterica (CobD)

SCOP Domain Sequences for d1kusa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kusa_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica}
hggnirepatvlgispdqlldfsaninplgmpvsvkralidnldcierypdadyfhlhqa
larhhqvpaswilagngetesiftvasglkprramivtpgfaeygralaqsgceirrwsl
readgwqltdailealtpdldclflctpnnptgllperpllqaiadrckslninlildea
fidfiphetgfipalkdnphiwvlrsltkfyaipglrlgylvnsddaamarmrrqqmpws
vnalaalagevalqdsawqqatwhwlreegarfyqalcqlplltvypgranylllrcere
didlqrrlltqrilirscanypgldsryyrvairsaaqnerllaalrnvltgiap

SCOP Domain Coordinates for d1kusa_:

Click to download the PDB-style file with coordinates for d1kusa_.
(The format of our PDB-style files is described here.)

Timeline for d1kusa_:

  • d1kusa_ is new in SCOP 1.59
  • d1kusa_ became obsolete in SCOP 1.61