Lineage for d1kswa3 (1ksw A:249-533)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734668Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 734669Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 734710Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 734788Protein c-src tyrosine kinase [56155] (2 species)
    PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase
  7. 734791Species Human (Homo sapiens) [TaxId:9606] [56156] (6 PDB entries)
  8. 734799Domain d1kswa3: 1ksw A:249-533 [68862]
    Other proteins in same PDB: d1kswa1, d1kswa2
    complexed with nbs; mutant

Details for d1kswa3

PDB Entry: 1ksw (more details), 2.8 Å

PDB Description: structure of human c-src tyrosine kinase (thr338gly mutant) in complex with n6-benzyl adp
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOP Domain Sequences for d1kswa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kswa3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
kpqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeafl
qeaqvmkklrheklvqlyavvseepiyivgeymskgslldflkgetgkylrlpqlvdmaa
qiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikw
tapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecp
eslhdlmcqcwrkepeerptfeylqafledyftstepqyqpgenl

SCOP Domain Coordinates for d1kswa3:

Click to download the PDB-style file with coordinates for d1kswa3.
(The format of our PDB-style files is described here.)

Timeline for d1kswa3: