SCOP 1.71: Domain d1kswa3: 1ksw A:249-533

Lineage for d1kswa3 (1ksw A:249-533)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (60 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein c-src tyrosine kinase [56155] (2 species)
   PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [56156] (3 PDB entries)

8. Domain d1kswa3: 1ksw A:249-533 [68862]
   Other proteins in same PDB: d1kswa1, d1kswa2
   complexed with nbs; mutant

Details for d1kswa3

PDB Entry: 1ksw, 2.8 Å

PDB Description: structure of human c-src tyrosine kinase (thr338gly mutant) in complex with n6-benzyl adp

SCOP Domain Sequences for d1kswa3:

Sequence; same for both SEQRES and ATOM records:

>d1kswa3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens)}
kpqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeafl
qeaqvmkklrheklvqlyavvseepiyivgeymskgslldflkgetgkylrlpqlvdmaa
qiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikw
tapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecp
eslhdlmcqcwrkepeerptfeylqafledyftstepqyqpgenl

Timeline for d1kswa3:

• d1kswa3 first appeared in SCOP 1.59
  
• d1kswa3 appears in SCOP 1.69
  
• d1kswa3 appears in SCOP 1.73
  
• d1kswa3 appears in the current release, SCOPe 2.08