Class b: All beta proteins [48724] (119 folds) |
Fold b.34: SH3-like barrel [50036] (12 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (1 family) |
Family b.34.2.1: SH3-domain [50045] (24 proteins) |
Protein c-src protein tyrosine kinase [50064] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [50065] (3 PDB entries) |
Domain d1kswa1: 1ksw A:84-145 [68860] Other proteins in same PDB: d1kswa2, d1kswa3 complexed with nbs; mutant |
PDB Entry: 1ksw (more details), 2.8 Å
SCOP Domain Sequences for d1kswa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kswa1 b.34.2.1 (A:84-145) c-src protein tyrosine kinase {Human (Homo sapiens)} ttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslstgqtgyipsnyvapsdsi qa
Timeline for d1kswa1: