Lineage for d1kswa1 (1ksw A:84-145)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 227526Fold b.34: SH3-like barrel [50036] (12 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 227568Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 227569Family b.34.2.1: SH3-domain [50045] (24 proteins)
  6. 227619Protein c-src protein tyrosine kinase [50064] (3 species)
  7. 227633Species Human (Homo sapiens) [TaxId:9606] [50065] (3 PDB entries)
  8. 227636Domain d1kswa1: 1ksw A:84-145 [68860]
    Other proteins in same PDB: d1kswa2, d1kswa3
    complexed with nbs; mutant

Details for d1kswa1

PDB Entry: 1ksw (more details), 2.8 Å

PDB Description: structure of human c-src tyrosine kinase (thr338gly mutant) in complex with n6-benzyl adp

SCOP Domain Sequences for d1kswa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kswa1 b.34.2.1 (A:84-145) c-src protein tyrosine kinase {Human (Homo sapiens)}
ttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslstgqtgyipsnyvapsdsi
qa

SCOP Domain Coordinates for d1kswa1:

Click to download the PDB-style file with coordinates for d1kswa1.
(The format of our PDB-style files is described here.)

Timeline for d1kswa1: