SCOP 1.65: Domain d1kqsy_: 1kqs Y:

Lineage for d1kqsy_ (1kqs Y:)

1. Root: SCOP 1.65

2. Class g: Small proteins [56992] (66 folds)

3. Fold g.41: Rubredoxin-like [57769] (12 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (4 families)

5. Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein)

6. Protein Ribosomal protein L37ae [57831] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [57832] (12 PDB entries)

8. Domain d1kqsy_: 1kqs Y: [68840]
   Other proteins in same PDB: d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsz_
   complexed with aca, btn, cd, cl, k, mg, na, pha, ppu

Details for d1kqsy_

PDB Entry: 1kqs, 3.1 Å

PDB Description: The Haloarcula marismortui 50S Complexed with a Pretranslocational Intermediate in Protein Synthesis

SCOP Domain Sequences for d1kqsy_:

Sequence; same for both SEQRES and ATOM records:

>d1kqsy_ g.41.8.1 (Y:) Ribosomal protein L37ae {Archaeon Haloarcula marismortui}
rtgrfgpryglkirvrvadveikhkkkhkcpvcgfkklkragtgiwmcghcgykiaggcy
qpetvagkavmka

Timeline for d1kqsy_:

• d1kqsy_ first appeared in SCOP 1.59
  
• d1kqsy_ appears in SCOP 1.63
  
• d1kqsy_ appears in SCOP 1.67
  
• d1kqsy_ appears in the current release, SCOPe 2.08