SCOP 1.69: Domain d1kqsx_: 1kqs X:

Lineage for d1kqsx_ (1kqs X:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.9: Barstar-like [52037] (2 superfamilies)
   2 layers, a/b; parallel beta-sheet of 3 strands, order 123

4. Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family)

5. Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
   contains irregular N-terminal extension to the common fold

6. Protein Ribosomal protein L32e [52044] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [52045] (19 PDB entries)

8. Domain d1kqsx_: 1kqs X: [68839]
   Other proteins in same PDB: d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsy_, d1kqsz_

Details for d1kqsx_

PDB Entry: 1kqs, 3.1 Å

PDB Description: The Haloarcula marismortui 50S Complexed with a Pretranslocational Intermediate in Protein Synthesis

SCOP Domain Sequences for d1kqsx_:

Sequence; same for both SEQRES and ATOM records:

>d1kqsx_ c.9.2.1 (X:) Ribosomal protein L32e {Archaeon Haloarcula marismortui}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev

Timeline for d1kqsx_:

• d1kqsx_ first appeared in SCOP 1.59
  
• d1kqsx_ appears in SCOP 1.67
  
• d1kqsx_ appears in SCOP 1.71
  
• d1kqsx_ appears in the current release, SCOPe 2.08