Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.29: Ribosomal protein L31e [54574] (1 superfamily) beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342 |
Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family) |
Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein) |
Protein Ribosomal protein L31e [54577] (1 species) |
Species Archaeon Haloarcula marismortui [TaxId:2238] [54578] (40 PDB entries) Uniprot P18138 |
Domain d1kqsw_: 1kqs W: [68838] Other proteins in same PDB: d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsx_, d1kqsy_, d1kqsz_ complexed with aca, btn, cd, cl, k, mg, na, pha, ppu |
PDB Entry: 1kqs (more details), 3.1 Å
SCOP Domain Sequences for d1kqsw_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kqsw_ d.29.1.1 (W:) Ribosomal protein L31e {Archaeon Haloarcula marismortui [TaxId: 2238]} ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant pskirvraarfeeegeaiveae
Timeline for d1kqsw_:
View in 3D Domains from other chains: (mouse over for more information) d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsx_, d1kqsy_, d1kqsz_ |