Lineage for d1kqsw_ (1kqs W:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 858025Fold d.29: Ribosomal protein L31e [54574] (1 superfamily)
    beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342
  4. 858026Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family) (S)
  5. 858027Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein)
  6. 858028Protein Ribosomal protein L31e [54577] (1 species)
  7. 858029Species Archaeon Haloarcula marismortui [TaxId:2238] [54578] (40 PDB entries)
    Uniprot P18138
  8. 858053Domain d1kqsw_: 1kqs W: [68838]
    Other proteins in same PDB: d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsx_, d1kqsy_, d1kqsz_
    complexed with aca, btn, cd, cl, k, mg, na, pha, ppu

Details for d1kqsw_

PDB Entry: 1kqs (more details), 3.1 Å

PDB Description: The Haloarcula marismortui 50S Complexed with a Pretranslocational Intermediate in Protein Synthesis
PDB Compounds: (W:) ribosomal protein l31e

SCOP Domain Sequences for d1kqsw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kqsw_ d.29.1.1 (W:) Ribosomal protein L31e {Archaeon Haloarcula marismortui [TaxId: 2238]}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae

SCOP Domain Coordinates for d1kqsw_:

Click to download the PDB-style file with coordinates for d1kqsw_.
(The format of our PDB-style files is described here.)

Timeline for d1kqsw_: