Lineage for d1kqsp_ (1kqs P:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2054645Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 2054646Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)
  6. 2054647Protein Ribosomal proteins L21e [50108] (1 species)
  7. 2054648Species Haloarcula marismortui [TaxId:2238] [50109] (40 PDB entries)
    Uniprot P12734
  8. 2054673Domain d1kqsp_: 1kqs P: [68831]
    Other proteins in same PDB: d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsy_, d1kqsz_
    protein/RNA complex; complexed with aca, btn, cd, cl, k, mg, na, pha, ppu

Details for d1kqsp_

PDB Entry: 1kqs (more details), 3.1 Å

PDB Description: The Haloarcula marismortui 50S Complexed with a Pretranslocational Intermediate in Protein Synthesis
PDB Compounds: (P:) ribosomal protein l21e

SCOPe Domain Sequences for d1kqsp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kqsp_ b.34.5.1 (P:) Ribosomal proteins L21e {Haloarcula marismortui [TaxId: 2238]}
pssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgqt
gtvegkqgdaykvdivdggkektiivtaahlrrqe

SCOPe Domain Coordinates for d1kqsp_:

Click to download the PDB-style file with coordinates for d1kqsp_.
(The format of our PDB-style files is described here.)

Timeline for d1kqsp_: