Class b: All beta proteins [48724] (144 folds) |
Fold b.34: SH3-like barrel [50036] (15 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.5: Translation proteins SH3-like domain [50104] (4 families) many known members contain KOW motif |
Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins) |
Protein Ribosomal proteins L21e [50108] (1 species) |
Species Archaeon Haloarcula marismortui [TaxId:2238] [50109] (19 PDB entries) |
Domain d1kqsp_: 1kqs P: [68831] Other proteins in same PDB: d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsy_, d1kqsz_ |
PDB Entry: 1kqs (more details), 3.1 Å
SCOP Domain Sequences for d1kqsp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kqsp_ b.34.5.1 (P:) Ribosomal proteins L21e {Archaeon Haloarcula marismortui} pssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgqt gtvegkqgdaykvdivdggkektiivtaahlrrqe
Timeline for d1kqsp_:
View in 3D Domains from other chains: (mouse over for more information) d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsy_, d1kqsz_ |