| Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
| Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily) core: three turns of irregular (beta-beta-alpha)n superhelix |
Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) ![]() |
| Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins) |
| Protein Ribosomal protein L18e [52084] (1 species) |
| Species Archaeon Haloarcula marismortui [TaxId:2238] [52085] (12 PDB entries) |
| Domain d1kqsn_: 1kqs N: [68829] Other proteins in same PDB: d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqso_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsy_, d1kqsz_ complexed with aca, btn, cd, cl, k, mg, na, pha, ppu |
PDB Entry: 1kqs (more details), 3.1 Å
SCOP Domain Sequences for d1kqsn_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kqsn_ c.12.1.1 (N:) Ribosomal protein L18e {Archaeon Haloarcula marismortui}
sktnprlssliadlksaarssggavwgdvaerlekprrthaevnlgrieryaqedetvvv
pgkvlgsgvlqkdvtvaavdfsgtaetkidqvgeavsleqaiennpegshvrvir
Timeline for d1kqsn_:
View in 3DDomains from other chains: (mouse over for more information) d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqso_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsy_, d1kqsz_ |