Lineage for d1kqsl_ (1kqs L:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 407471Fold d.12: Ribosomal proteins L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 407472Superfamily d.12.1: Ribosomal proteins L23 and L15e [54189] (2 families) (S)
  5. 407496Family d.12.1.2: L15e [54193] (1 protein)
    elaborated with additional structures
  6. 407497Protein Ribosomal protein L15e [54194] (1 species)
  7. 407498Species Archaeon Haloarcula marismortui [TaxId:2238] [54195] (18 PDB entries)
  8. 407510Domain d1kqsl_: 1kqs L: [68827]
    Other proteins in same PDB: d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsy_, d1kqsz_
    complexed with aca, btn, cd, cl, k, mg, na, pha, ppu

Details for d1kqsl_

PDB Entry: 1kqs (more details), 3.1 Å

PDB Description: The Haloarcula marismortui 50S Complexed with a Pretranslocational Intermediate in Protein Synthesis

SCOP Domain Sequences for d1kqsl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kqsl_ d.12.1.2 (L:) Ribosomal protein L15e {Archaeon Haloarcula marismortui}
arsaysyireawkrpkegqiaelmwhrmqewrnepavvrierptrldrarslgykakqgi
ivvrvairkgssrrtrfnkgrrskrmmvnritrkkniqriaeeranrkfpnlrvlnsysv
gedgrhkwhevilidpdhpaiksddqlswisrtrhrlrtfrgltsagrrcrglrgqgkgs
ekvrpslrvngaka

SCOP Domain Coordinates for d1kqsl_:

Click to download the PDB-style file with coordinates for d1kqsl_.
(The format of our PDB-style files is described here.)

Timeline for d1kqsl_: