Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily) core: three turns of irregular (beta-beta-alpha)n superhelix |
Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) |
Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins) |
Protein Ribosomal protein L15 (L15p) [52082] (4 species) |
Species Haloarcula marismortui [TaxId:2238] [52083] (40 PDB entries) Uniprot P12737 |
Domain d1kqsk_: 1kqs K: [68826] Other proteins in same PDB: d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsy_, d1kqsz_ protein/RNA complex; complexed with aca, btn, cd, cl, k, mg, na, pha, ppu |
PDB Entry: 1kqs (more details), 3.1 Å
SCOPe Domain Sequences for d1kqsk_:
Sequence, based on SEQRES records: (download)
>d1kqsk_ c.12.1.1 (K:) Ribosomal protein L15 (L15p) {Haloarcula marismortui [TaxId: 2238]} tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee aatidvreidenvtllaaddvaevedggfrvdvrdvveeaddadyvkvlgagqvrheltl iaddfsegarekvegaggsveltdlgeerq
>d1kqsk_ c.12.1.1 (K:) Ribosomal protein L15 (L15p) {Haloarcula marismortui [TaxId: 2238]} tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee aatidvreidenvtllaaddvaefrvdvrdvveeaddadyvkvlgagqvrheltliaddf segarekvegaggsveltdlgeerq
Timeline for d1kqsk_:
View in 3D Domains from other chains: (mouse over for more information) d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsy_, d1kqsz_ |