Lineage for d1kqsc_ (1kqs C:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 177528Fold c.22: Ribosomal protein L4 [52165] (1 superfamily)
  4. 177529Superfamily c.22.1: Ribosomal protein L4 [52166] (1 family) (S)
  5. 177530Family c.22.1.1: Ribosomal protein L4 [52167] (1 protein)
  6. 177531Protein Ribosomal protein L4 [52168] (2 species)
  7. 177532Species Archaeon Haloarcula marismortui [TaxId:2238] [52170] (7 PDB entries)
  8. 177534Domain d1kqsc_: 1kqs C: [68817]
    Other proteins in same PDB: d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsy_, d1kqsz_

Details for d1kqsc_

PDB Entry: 1kqs (more details), 3.1 Å

PDB Description: The Haloarcula marismortui 50S Complexed with a Pretranslocational Intermediate in Protein Synthesis

SCOP Domain Sequences for d1kqsc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kqsc_ c.22.1.1 (C:) Ribosomal protein L4 {Archaeon Haloarcula marismortui}
mqatiydldgntdgevdlpdvfetpvrsdligkavraaqanrkqdygsdeyaglrtpaes
fgsgrgqahvpkldgrarrvpqavkgrsahppktekdrsldlndkerqlavrsalaatad
adlvadrghefdrdevpvvvsddfedlvktqevvsllealdvhadidradetkikagqgs
argrkyrrpasilfvtsdepstaarnlagadvatasevntedlapggapgrltvftesal
aevaer

SCOP Domain Coordinates for d1kqsc_:

Click to download the PDB-style file with coordinates for d1kqsc_.
(The format of our PDB-style files is described here.)

Timeline for d1kqsc_: