Lineage for d1kq3a_ (1kq3 A:)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1694360Fold e.22: Dehydroquinate synthase-like [56795] (1 superfamily)
    2 domains: (1) alpha/beta of a Rossmann-fold topology, binds NAD (2) multihelical array
  4. 1694361Superfamily e.22.1: Dehydroquinate synthase-like [56796] (3 families) (S)
  5. 1694391Family e.22.1.2: Iron-containing alcohol dehydrogenase [69892] (6 proteins)
    Pfam PF00465
  6. 1694398Protein Glycerol dehydrogenase [69893] (2 species)
  7. 1694403Species Thermotoga maritima [TaxId:2336] [69895] (1 PDB entry)
    TM0423
  8. 1694404Domain d1kq3a_: 1kq3 A: [68790]
    structural genomics
    complexed with cl, trs, zn

Details for d1kq3a_

PDB Entry: 1kq3 (more details), 1.5 Å

PDB Description: crystal structure of a glycerol dehydrogenase (tm0423) from thermotoga maritima at 1.5 a resolution
PDB Compounds: (A:) glycerol dehydrogenase

SCOPe Domain Sequences for d1kq3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kq3a_ e.22.1.2 (A:) Glycerol dehydrogenase {Thermotoga maritima [TaxId: 2336]}
hmitttifpgryvqgagainileeelsrfgerafvviddfvdknvlgenffssftkvrvn
kqifggecsdeeierlsglveeetdvvvgigggktldtakavayklkkpvvivptiastd
apcsalsviytpngefkrylflprnpdvvlvdteivakaparflvagmgdalatwfeaes
ckqkyapnmtgrlgsmtayalarlcyetlleygvlakrsveeksvtpalekiveantlls
glgfesgglaaahaihngltvlenthkylhgekvaigvlaslfltdkprkmieevysfce
evglpttlaeigldgvsdedlmkvaekacdknetihnepqpvtskdvffalkaadrygrm
rknl

SCOPe Domain Coordinates for d1kq3a_:

Click to download the PDB-style file with coordinates for d1kq3a_.
(The format of our PDB-style files is described here.)

Timeline for d1kq3a_: