Lineage for d1kq3a1 (1kq3 A:1-363)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2573692Fold e.22: Dehydroquinate synthase-like [56795] (1 superfamily)
    2 domains: (1) alpha/beta of a Rossmann-fold topology, binds NAD (2) multihelical array
  4. 2573693Superfamily e.22.1: Dehydroquinate synthase-like [56796] (3 families) (S)
  5. 2573723Family e.22.1.2: Iron-containing alcohol dehydrogenase [69892] (6 proteins)
    Pfam PF00465
  6. 2573731Protein Glycerol dehydrogenase [69893] (2 species)
  7. 2573736Species Thermotoga maritima [TaxId:2336] [69895] (1 PDB entry)
    TM0423
  8. 2573737Domain d1kq3a1: 1kq3 A:1-363 [68790]
    Other proteins in same PDB: d1kq3a2
    structural genomics
    complexed with cl, trs, zn

Details for d1kq3a1

PDB Entry: 1kq3 (more details), 1.5 Å

PDB Description: crystal structure of a glycerol dehydrogenase (tm0423) from thermotoga maritima at 1.5 a resolution
PDB Compounds: (A:) glycerol dehydrogenase

SCOPe Domain Sequences for d1kq3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kq3a1 e.22.1.2 (A:1-363) Glycerol dehydrogenase {Thermotoga maritima [TaxId: 2336]}
mitttifpgryvqgagainileeelsrfgerafvviddfvdknvlgenffssftkvrvnk
qifggecsdeeierlsglveeetdvvvgigggktldtakavayklkkpvvivptiastda
pcsalsviytpngefkrylflprnpdvvlvdteivakaparflvagmgdalatwfeaesc
kqkyapnmtgrlgsmtayalarlcyetlleygvlakrsveeksvtpalekiveantllsg
lgfesgglaaahaihngltvlenthkylhgekvaigvlaslfltdkprkmieevysfcee
vglpttlaeigldgvsdedlmkvaekacdknetihnepqpvtskdvffalkaadrygrmr
knl

SCOPe Domain Coordinates for d1kq3a1:

Click to download the PDB-style file with coordinates for d1kq3a1.
(The format of our PDB-style files is described here.)

Timeline for d1kq3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kq3a2