Lineage for d1kplc_ (1kpl C:)

  1. Root: SCOP 1.65
  2. 340091Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)
  3. 340637Fold f.20: Clc chloride channel [81341] (1 superfamily)
    core: 18 transmembrane helices
  4. 340638Superfamily f.20.1: Clc chloride channel [81340] (1 family) (S)
  5. 340639Family f.20.1.1: Clc chloride channel [69912] (1 protein)
    duplication: consist of two similar structural parts
  6. 340640Protein Clc chloride channel [69913] (2 species)
  7. 340654Species Salmonella typhimurium [TaxId:90371] [69915] (1 PDB entry)
  8. 340657Domain d1kplc_: 1kpl C: [68784]

Details for d1kplc_

PDB Entry: 1kpl (more details), 3 Å

PDB Description: Crystal Structure of the ClC Chloride Channel from S. typhimurium

SCOP Domain Sequences for d1kplc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kplc_ f.20.1.1 (C:) Clc chloride channel {Salmonella typhimurium}
tplailfmaavvgtltglvgvafekavswvqnmrigalvqvadhafllwplafilsalla
mvgyflvrkfapeaggsgipeiegaleelrpvrwwrvlpvkfiggmgtlgagmvlgregp
tvqiggnlgrmvldvfrmrsaearhtllatgaaaglsaafnaplagilfiieemrpqfry
nlisikavftgvimssivfrifngeapiievgklsdapvntlwlylilgiifgvvgpvfn
slvlrtqdmfqrfhggeikkwvlmggaigglcgilgliepaaagggfnlipiaaagnfsv
glllfifitrvvttllcfssgapggifapmlalgtllgtafgmaaavlfpqyhleagtfa
iagmgalmaasvrapltgivlvlemtdnyqlilpmiitclgatllaqflggkplystila
rtlakqdaeq

SCOP Domain Coordinates for d1kplc_:

Click to download the PDB-style file with coordinates for d1kplc_.
(The format of our PDB-style files is described here.)

Timeline for d1kplc_: