Lineage for d1kpkd_ (1kpk D:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1697321Fold f.20: Clc chloride channel [81341] (1 superfamily)
    core: 18 transmembrane helices
  4. 1697322Superfamily f.20.1: Clc chloride channel [81340] (1 family) (S)
  5. 1697323Family f.20.1.1: Clc chloride channel [69912] (2 proteins)
    duplication: consist of two similar structural parts
  6. 1697324Protein Clc chloride channel [69913] (2 species)
  7. 1697325Species Escherichia coli [TaxId:562] [69914] (18 PDB entries)
  8. 1697361Domain d1kpkd_: 1kpk D: [68779]

Details for d1kpkd_

PDB Entry: 1kpk (more details), 3.5 Å

PDB Description: Crystal Structure of the ClC Chloride Channel from E. coli
PDB Compounds: (D:) putative channel transporter

SCOPe Domain Sequences for d1kpkd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kpkd_ f.20.1.1 (D:) Clc chloride channel {Escherichia coli [TaxId: 562]}
qaarlrrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvht
adnypllltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvk
ffgglgtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafn
aplagilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplnt
lwlylilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapa
tsgggfnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtaf
gmvavelfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglg
atllaqftggkplysailartlakqeaeql

SCOPe Domain Coordinates for d1kpkd_:

Click to download the PDB-style file with coordinates for d1kpkd_.
(The format of our PDB-style files is described here.)

Timeline for d1kpkd_: