Lineage for d1kpkd_ (1kpk D:)

  1. Root: SCOP 1.59
  2. 141686Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 141752Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 141753Superfamily f.2.1: Membrane all-alpha [56869] (11 families) (S)
  5. 142224Family f.2.1.13: Clc chloride channel [69912] (1 protein)
  6. 142225Protein Clc chloride channel [69913] (2 species)
  7. 142226Species Escherichia coli [TaxId:562] [69914] (1 PDB entry)
  8. 142230Domain d1kpkd_: 1kpk D: [68779]

Details for d1kpkd_

PDB Entry: 1kpk (more details), 3.5 Å

PDB Description: Crystal Structure of the ClC Chloride Channel from E. coli
PDB Compounds: (D:)

SCOP Domain Sequences for d1kpkd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kpkd_ f.2.1.13 (D:) Clc chloride channel {Escherichia coli}
qaarlrrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvht
adnypllltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvk
ffgglgtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafn
aplagilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplnt
lwlylilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapa
tsgggfnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtaf
gmvavelfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglg
atllaqftggkplysailartlakqeaeql

SCOP Domain Coordinates for d1kpkd_:

Click to download the PDB-style file with coordinates for d1kpkd_.
(The format of our PDB-style files is described here.)

Timeline for d1kpkd_: